Recombinant Mouse Fc gamma RII is produced by our Mammalian expression system and the target gene encoding Thr30-Pro210 is expressed with a 6His tag at the C-terminus.

Fc γRII蛋白；CD32b蛋白；FCGR2蛋白;Low affinity immunoglobulin gamma Fc region receptor II; Fc gamma receptor IIB; Fc-gamma RII; Fc-gamma-RIIB; FcRII; IgG Fc receptor II beta; Lymphocyte antigen 17; Ly-17; CD32; Fcgr2; Fcgr2b; Ly-17; CD32b

Mouse

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDS GEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVR YHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Low affinity immunoglobulin gamma Fc region receptor II (CD32B) is a single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains. The inhibitory CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis. Co-ligation of CD32B on dendritic cells inhibits maturation and blocks cell activation. CD32B may also be a target formonoclonal antibody therapy for malignancies.

P08101