Recombinant Human 0 is produced by our Mammalian expression system and the target gene encoding Trp21-Asn343 is expressed with a 6His tag at the C-terminus.

Poliovirus Receptor蛋白；PVR蛋白；CD155蛋白;Poliovirus Receptor; Nectin-Like Protein 5; NECL-5; CD155; PVR; PVS

Human

Human Cells

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPS YSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAE VQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVD GKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNP

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Poliovirus Receptor (PVR) is a 70 kDa type I transmembrane single-span glycoprotein that belongs to the nectin-like (Necl) family and was originally identified based on its ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. PVR contains three Ig-like extracellular domains, a transmembrane segment, and a cytoplasmic tail. The normal cellular function of PVR maybe the involvement of intercellular adhension between epithelial cells. Alternate splicing of the PVR mRNA yields four different isoforms (α, β, γ, and δ) with identical extracellular domains.

P15151