Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a 6His tag at the C-terminus.

CD3 ε蛋白；CD3E蛋白;T-Cell Surface Glycoprotein CD3 Epsilon Chain; T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e; CD3E; T3E

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEF SELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

T-Cell Surface Glycoprotein CD3 ε Chain (CD3ε) is a single-pass type I membrane protein. CD3ε contains 1 Ig-like (immunoglobulin-like) domain and 1 ITAM domain. CD3ε is a polypeptide encoded by the CD3E gene on chromosome 11 in humans. The T cell receptor-CD3 complex (TCR/CD3 complex) is involved in T-cell development and several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs). TCR/CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.

P07766