Recombinant Mouse Serpin F1/PEDF is produced by our E.coli expression system and the target gene encoding Asp43-Thr417 is expressed.

PEDF蛋白；SERPIN F1蛋白;Pigment epithelium-derived factor; Pedf; Sdf3; Caspin; Serpin F1; Stromal cell-derived factor 3.

Mouse

Escherichia coli.

Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRA LYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGN PRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLT

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Serpin F1 is secreted Neurotrophic protein and belongs to the serpin family. Serpin F1 Highly expressed in the liver, gastric glandular mucosa and renal tubules. It is also expressed in the brain, heart, lung retina and testes. It induces extensive neuronal differentiation in retinoblastoma cells. It is potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, exhibits no serine protease inhibitory activity.

P97298