Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus.

Sialidase-1蛋白；NEU-1蛋白;Sialidase-1; Acetylneuraminyl Hydrolase; G9 Sialidase; Lysosomal Sialidase; N-Acetyl-Alpha-Neuraminidase 1; NEU1; NANH

Human

Human Cells

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl,10% Glycerol, pH 7.4.

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALR RSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDD GVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRY GSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDAC

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), β-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.

Q99519