Recombinant Human Proteinase 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Arg249 is expressed with a 6His tag at the C-terminus.

ase 3蛋白；PRTN3蛋白；Myeloblastin蛋白;Myeloblastin; AGP7; C-ANCA Antigen; Leukocyte Proteinase 3; PR-3; PR3; Neutrophil Proteinase 4; NP-4; P29; Wegener Autoantigen; PRTN3; MBN

Human

Human Cells

Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNV RTQEPTQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQDQPVPHGTQCLAM GWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFV IWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Proteinase-3 is a neutral serine proteinase that belongs to the peptidase S1 family and Elastase subfamily. It contains one peptidase S1 domain and it is expressed mainly in neutrophil granulocytes. The primary function of Proteinase-3 is thought to be degradation of extracellular proteins at sites of inflammation, but excessive or prolonged proteolytic activity may cause harmful effects in the body. It is the epitope of anti-neutrophil cytoplasmic antibodies (ANCAs) of the cANCA (cytoplasmic subtype) class, a type of antibody frequently found in the disease Wegener's granulomatosis.

P24158