Recombinant Human Alkaline Phosphatase is produced by our Mammalian expression system and the target gene encoding Ile23-Asp506 is expressed with a 6His tag at the C-terminus.

Alkaline Phosphatase蛋白；ALPP蛋白；PLAP蛋白;Alkaline phosphatase; placental type; also known as Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; ALPP and PLAP; belongs to the alkaline phosphatase family.

Human

Human Cells

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 .

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGP EIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVI SVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMD IDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTE

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

ALPP is a membrane protein and exits as a homodimer. ALPP is expressed only in normal term placenta, endocervix and fallopian tube and also in ovarian and proximal gastrointestinal tumors. It has been shown to play a role in a number of processes including cell signaling, long-term potentiation, and cell adhesion, however, the best known and most commonly studied role is implicated in Alzheimer's research.

P05187