Recombinant Human Interleukin-11 is produced by our Yeast expression system and the target gene encoding Gly23-Leu199 is expressed.

Interleukin-11蛋白；IL-11蛋白;Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11

Human

Yeast

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGA LQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQP PPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Interleukin 11 (IL-11) is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. IL-11 is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors.

P20809