Recombinant human Interleukin-7 receptor alpha is produced by our Mammalian expression system and the target gene encoding Glu21-Gly236 is expressed with a Fc, 6His tag at the C-terminus.

IL-7RA蛋白；CD127蛋白;Interleukin-7 receptor subunit alpha; IL7R; IL-7R-alpha; CD127

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNF RKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTF NTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKG FWSEWSPSYYFRTPEINNSSGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Interleukin 7 Receptor alpha (IL-7Rα), also known as CD127, is a 75 kDa hematopoietin receptor superfamily member that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7Rα is majorly expressed on T cells and their precursors, and early in B cell development as well, prior to the appearance of surface IgM. Dynamic regulation of IL-7Rα is important for the generation of appropriate immune responses.

P16871