Recombinant Human Interleukin-21 Receptor is produced by our Mammalian expression system and the target gene encoding Cys20-Pro236 is expressed with a 6His tag at the C-terminus.

IL-21 Receptor蛋白；IL-21R蛋白;Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360.

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMD VFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYM LKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTW SEWSDPVIFQTQSEELKEGWNPVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Interleukin-21 receptor is also known as IL-21 receptor, IL-21R, CD360. In humans, it is encoded by the IL21R gene. It belongs to the type I cytokine receptor family. Type 4 subfamily contains 2 fibronectin type-III domains. Interleukin-21 receptor is selectively expressed in lymphoid tissues and highly expressed in thymus and spleen. IL-21 is produced by CD4+ T cells in response to antigenic stimulation. Its action enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells. It also promotes the anti-tumor activity of CD8+ T-cells and NK cells.

Q9HBE5