Recombinant Human C-X-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the N-terminus.

CXCL3蛋白；GROγ蛋白;C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATL KNGKKACLNPASPMVQKIIEKILNKGSTN

N-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

P19876