Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed.

CXCL14蛋白;C-X-C Motif Chemokine 14; Chemokine BRAKm MIP-2G; Small-Inducible Cytokine B14; CXCL14; MIP2G; NJAC; SCYB14

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY NAWNEKRRVYEE

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.

O95715