Recombinant Human C-C Motif Chemokine 28 is produced by our E.coli expression system and the target gene encoding Ile20-Tyr127 is expressed.

CCL28蛋白;C-C Motif Chemokine 28; Mucosae-Associated Epithelial Chemokine; MEC; Protein CCK1; Small-Inducible Cytokine A28; CCL28; SCYA28

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQ WMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Chemokine (C-C Motif) Ligand 28 (CCL28) is a novel chemokine that shares the most homology with CCL27/CTACK. CCL28 shows chemotactic activity for resting CD4, CD8 T-cells and eosinophils. It Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCR10 (GPR2 orphan receptor) is also the receptor for CCL27/CTACK. CCL28 is preferentially expressed by epithelial cells of diverse tissues, with highest expression level in normal and pathological colon. It is also expressed in normal and asthmatic lung tissues. Human and mouse CCL28 shares 83% sequence identity in their mature regions.

Q9NRJ3