Recombinant Human C-C Motif Chemokine 27 is produced by our E.coli expression system and the target gene encoding Phe25-Gly112 is expressed.

CCL27蛋白;C-C Motif Chemokine 27; CC Chemokine ILC; Cutaneous T-Cell-Attracting Chemokine; CTACK; Eskine; IL-11 R-Alpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; CCL27; ILC; SCYA27

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, pH 7.5.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWF EHQERKLHGTLPKLNFGMLRKMG

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form.

Q9Y4X3