Recombinant Human C-C Motif Chemokine 24 is produced by our Mammalian expression system and the target gene encoding Val27-Cys119 is expressed with a 6His tag at the C-terminus.

CCL24蛋白；Eotaxin-2蛋白；MPIF-2蛋白;C-C motif chemokine 24 (CCL24); CK-beta-6; Eosinophil chemotactic protein; Eotaxin-2; Myeloid progenitor inhibitory factor 2; Small-inducible cytokine A24; Ckb-6; MPIF-2; SCYA24

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDA KQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Cytokine are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine. CCL24 diaplays the chemotactic for resting T-lymphocytes and eosinophils. CCL24 has lower chemotatic activity for neutrophils, none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell lines.

O00175