Recombinant Human Receptor Expressed in Lymphoid Tissues is produced by our Mammalian expression system and the target gene encoding Ser26-Ala160 is expressed with a Fc tag at the C-terminus.

RELT蛋白；TNFRSF19L蛋白;Tumor necrosis factor receptor superfamily member 19L; TNFRSF19L; Receptor expressed in lymphoid tissues; RELT

Human

Human Cells

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLC GDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGG PEETAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV

C-Fc

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Tumor necrosis factor receptor superfamily member 19L (TNFRSF19L), also known as Receptor expressed in lymphoid tissues and RELT, is a member of the TNF-receptor superfamily. TNFRSF19L is a single-pass type membrane protein and contains one TNFR-Cys repeat. TNFRSF19L is highly expressed in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. It has been shown TNFRSF19L activates the NF-kappaB pathway and selectively binds TNF receptor-associated factor 1 (TRAF1). TNFRSF19L is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response.

Q969Z4