Recombinant Human OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 6His tag at the N-terminus.

OX40 Ligand蛋白；TNFSF4蛋白；OX40L蛋白;Tumor necrosis factor ligand superfamily member 4; Glycoprotein Gp34; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; TNFSF4; CD252; TXGP1

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

HHHHHHQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYF SQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIH QNPGEFCVL

N-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is the ligand for CD134 and is expressed on such cells as DC2s enabling amplification of Th2 cell differentiation. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. It has been found association with systemic lupus erythematosus, No association with occurrence of atherosclerosis.

P23510