Recombinant Human GITR Ligand is produced by our Mammalian expression system and the target gene encoding Glu74-Ser199 is expressed with a 6His tag at the C-terminus.

GITR蛋白；TNFRSF18蛋白；CD357蛋白;Tumor necrosis factor ligand superfamily member 18; TNFSF18; Activation-inducible TNF-related ligand; Glucocorticoid-induced TNF-related ligand; AITRL; GITRL; TL6

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVR LYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISVDHH HHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B.

Q9UNG2