Recombinant Human 4-1BB ligand is produced by our E.coli expression system and the target gene encoding Arg71-Glu254 is expressed with a 6His tag at the C-terminus.

4-1BB Ligand蛋白；4-1BBL蛋白；TNFSF9蛋白；CD137L蛋白;Tumor necrosis factor ligand superfamily member 9; 4-1BB ligand; 4-1BBL; TNFSF9;CD137L

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELV VAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGF QGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSELEHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumor necrosis factor family. It is a 254 amino acids cytokine that is expressed in brain, placenta, lung, skeletal muscle and kidney. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells, and is thought to be involved in T cell-tumor cell interaction.

P41273