Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus.

TDGF1蛋白；Cripto蛋白;Teratocarcinoma-derived growth factor 1; Cripto-1 growth factor; CRGF; Epidermal growth factor-like cripto protein CR1; TDGF1; CRIPTO

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFC ACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVA SRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY

C-Fc

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Teratocarcinoma-derived growth factor 1(TDGF1) is a Cell membrane protein and contains 1 EGF-like domain. The protein plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. It also may play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

P13385