Recombinant Human Fibroblast Growth Factor 12 is produced by our E.coli expression system and the target gene encoding Met1-Thr181 is expressed.

FGF-12蛋白;Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-Activating Factor; FGF12; FGF12B; FHF1

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5mM EDTA, pH 7.5.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

MESKEPQLKGIVTRLFSQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYV AMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQESGRAWFLGLNKEGQIMKGNRVKKT KPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Immobilized Human FGF-12 at 2ug/ml (100 μl/well) can bind Human FGFR3-Fc . The ED50 of Human FGF-12 is 0.5-4 ug/ml .

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

P61328