Recombinant Human Ephrin-B2 is produced by our Mammalian expression system and the target gene encoding Ile28-Ala229 is expressed with a 6His tag at the C-terminus.

Ephrin-B2蛋白；EFNB2蛋白;Ephrin-B2; EPH-Related Receptor Tyrosine Kinase Ligand 5; LERK-5; HTK Ligand; HTK-L; EFNB2; EPLG5; HTKL; LERK5

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIK KENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRA MKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILG SEVALFAVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Immobilized Human EphB2-Fc at 10μg/ml (100 μl/well) can bind Human AQZ9-His .The ED50 of Human AQZ9-His is 1.13ug/ml .

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Ephrin-B2 is a type I transmembrane protein and belongs the Ephrin family. It binds to the receptor tyrosine kinases, such as EPHA4, EPHB4 and EPHA3. Ephrin-B2 has been implicated in mediating developmental events, especially in the nervous system, erythropoiesis and tumour metastasis. Ligation of Ephrin-B2 with complementary EphB receptors on adjacent cells results in a combination of forward (EphB receptors) and reverse (Ephrin-B2) signalling, which is central to tissue development and remodelling functions. In addition, Ephrin-B2 may play a role in constraining the orientation of longitudinally projecting axons.

P52799